PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C020225P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 265aa    MW: 29721.4 Da    PI: 5.8554
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C020225P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.92.7e-141462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l++ +   G   +W+++++  g+ R++k+c++rw +yl
   MELO3C020225P1 14 KGPWTSEEDKKLINFIVTNGQScCWRAVPKLAGLLRCGKSCRLRWTNYL 62
                     79******************99***********99************97 PP

2Myb_DNA-binding50.64.4e-1675112847
                      HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      E++  +d+++qlG++ W++Ia++++ gRt++++k++w+++
   MELO3C020225P1  75 EEKMVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 112
                      999************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-19563IPR009057Homeodomain-like
PROSITE profilePS5129413.142962IPR017930Myb domain
SuperFamilySSF466895.62E-2511109IPR009057Homeodomain-like
SMARTSM007171.5E-101364IPR001005SANT/Myb domain
PfamPF002492.6E-131462IPR001005SANT/Myb domain
CDDcd001674.96E-71662No hitNo description
PROSITE profilePS5129424.9963117IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-2464118IPR009057Homeodomain-like
SMARTSM007171.7E-1367115IPR001005SANT/Myb domain
PfamPF002491.0E-1375112IPR001005SANT/Myb domain
CDDcd001677.27E-1175113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MGRQPCCEKV GLKKGPWTSE EDKKLINFIV TNGQSCCWRA VPKLAGLLRC GKSCRLRWTN  60
YLRPDLKRGL LSDFEEKMVI DLHAQLGNRW SKIASHLPGR TDNEIKNHWN THIKKKLKKM  120
GIDPQTHKPI SISTDSHQSN LPSHLDMEMS PSSPVNIAET KDPAEVITST TAIEPKTPPL  180
NSCVSSTWSS STSPSSSSTN SNLIKFDDLE FPDFEWVCSN DTSNNNDNDI GFWEDDDFSS  240
WDFLVGHEDG EVPIFQESWP CGLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26121175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818540.0LN681854.1 Cucumis melo genomic scaffold, anchoredscaffold00042.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008457024.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX62e-81ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0A0L7231e-154A0A0A0L723_CUCSA; Uncharacterized protein
STRINGVIT_14s0006g00450.t016e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.18e-89myb domain protein 20